Lineage for d4fm4k_ (4fm4 K:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2548277Fold d.149: Nitrile hydratase alpha chain [56208] (1 superfamily)
    4 layers a/b/b/a; inside is a sandwich of two 2-stranded beta-sheets
  4. 2548278Superfamily d.149.1: Nitrile hydratase alpha chain [56209] (2 families) (S)
    duplication: contains two structural repeats
  5. 2548357Family d.149.1.0: automated matches [193574] (1 protein)
    not a true family
  6. 2548358Protein automated matches [193575] (1 species)
    not a true protein
  7. 2548359Species Comamonas testosteroni [TaxId:285] [193576] (1 PDB entry)
  8. 2548365Domain d4fm4k_: 4fm4 K: [202055]
    Other proteins in same PDB: d4fm4b_, d4fm4d_, d4fm4f_, d4fm4h_, d4fm4j_, d4fm4l_, d4fm4n_, d4fm4p_
    automated match to d4fm4o_
    complexed with fe, po4

Details for d4fm4k_

PDB Entry: 4fm4 (more details), 2.38 Å

PDB Description: Wild Type Fe-type Nitrile Hydratase from Comamonas testosteroni Ni1
PDB Compounds: (K:) Nitrile hydratase alpha subunit

SCOPe Domain Sequences for d4fm4k_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fm4k_ d.149.1.0 (K:) automated matches {Comamonas testosteroni [TaxId: 285]}
tdnavmeqrvdalfvltkelglvtdqtvpdyedalmhdwlpqngaklvakawtdpvfkaq
llsegvaaseslgfsfpkhhkhfvvlentpelhnviccslcsctaftiigmapdwykele
yrarivrqartvlkeigldlpesidirvwdttadtrymvlplrpqgtedwseaqlatlit
qdcligvsrleapfaalpapavalga

SCOPe Domain Coordinates for d4fm4k_:

Click to download the PDB-style file with coordinates for d4fm4k_.
(The format of our PDB-style files is described here.)

Timeline for d4fm4k_: