Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.149: Nitrile hydratase alpha chain [56208] (1 superfamily) 4 layers a/b/b/a; inside is a sandwich of two 2-stranded beta-sheets |
Superfamily d.149.1: Nitrile hydratase alpha chain [56209] (2 families) duplication: contains two structural repeats |
Family d.149.1.0: automated matches [193574] (1 protein) not a true family |
Protein automated matches [193575] (1 species) not a true protein |
Species Comamonas testosteroni [TaxId:285] [193576] (1 PDB entry) |
Domain d4fm4i_: 4fm4 I: [202054] Other proteins in same PDB: d4fm4b_, d4fm4d_, d4fm4f_, d4fm4h_, d4fm4j_, d4fm4l_, d4fm4n_, d4fm4p_ automated match to d4fm4o_ complexed with fe, po4 |
PDB Entry: 4fm4 (more details), 2.38 Å
SCOPe Domain Sequences for d4fm4i_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4fm4i_ d.149.1.0 (I:) automated matches {Comamonas testosteroni [TaxId: 285]} tdnavmeqrvdalfvltkelglvtdqtvpdyedalmhdwlpqngaklvakawtdpvfkaq llsegvaaseslgfsfpkhhkhfvvlentpelhnviccslcsctaftiigmapdwykele yrarivrqartvlkeigldlpesidirvwdttadtrymvlplrpqgtedwseaqlatlit qdcligvsrleapfaalpapavalga
Timeline for d4fm4i_: