Lineage for d1d5bb1 (1d5b B:1-113)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 651989Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)
  6. 652160Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 652563Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (148 PDB entries)
  8. 652719Domain d1d5bb1: 1d5b B:1-113 [20205]
    Other proteins in same PDB: d1d5ba1, d1d5ba2, d1d5bb2, d1d5bh2, d1d5bl1, d1d5bl2
    part of humanized oxy-cope catalytic Fab az-28

Details for d1d5bb1

PDB Entry: 1d5b (more details), 2.8 Å

PDB Description: unliganded mature oxy-cope catalytic antibody
PDB Compounds: (B:) chimeric OXY-COPE catalytic ANTIBODY AZ-28 (HEAVY chain)

SCOP Domain Sequences for d1d5bb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d5bb1 b.1.1.1 (B:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]}
qvqlqqsgaelmkpgasvkisckatgytfssfwiewvkqrpghglewigeilpgsggthy
nekfkgkatftadkssntaymqlssltsedsavyycarghsyyfydgdywgqgtsvtvss

SCOP Domain Coordinates for d1d5bb1:

Click to download the PDB-style file with coordinates for d1d5bb1.
(The format of our PDB-style files is described here.)

Timeline for d1d5bb1: