| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.149: Nitrile hydratase alpha chain [56208] (1 superfamily) 4 layers a/b/b/a; inside is a sandwich of two 2-stranded beta-sheets |
Superfamily d.149.1: Nitrile hydratase alpha chain [56209] (2 families) ![]() duplication: contains two structural repeats |
| Family d.149.1.0: automated matches [193574] (1 protein) not a true family |
| Protein automated matches [193575] (1 species) not a true protein |
| Species Comamonas testosteroni [TaxId:285] [193576] (1 PDB entry) |
| Domain d4fm4a_: 4fm4 A: [202046] Other proteins in same PDB: d4fm4b_, d4fm4d_, d4fm4f_, d4fm4h_, d4fm4j_, d4fm4l_, d4fm4n_, d4fm4p_ automated match to d4fm4o_ complexed with fe, po4 |
PDB Entry: 4fm4 (more details), 2.38 Å
SCOPe Domain Sequences for d4fm4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4fm4a_ d.149.1.0 (A:) automated matches {Comamonas testosteroni [TaxId: 285]}
tdnavmeqrvdalfvltkelglvtdqtvpdyedalmhdwlpqngaklvakawtdpvfkaq
llsegvaaseslgfsfpkhhkhfvvlentpelhnviccslcsctaftiigmapdwykele
yrarivrqartvlkeigldlpesidirvwdttadtrymvlplrpqgtedwseaqlatlit
qdcligvsrleapfaalpapavalga
Timeline for d4fm4a_: