Lineage for d4fkzb_ (4fkz B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2142044Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
    consists of two non-similar domains with 3 layers (a/b/a) each
    domain 1: parallel beta-sheet of 7 strands, order 3214567
    domain 2: parallel beta-sheet of 6 strands, order 321456
  4. 2142045Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (14 families) (S)
  5. 2142080Family c.87.1.3: UDP-N-acetylglucosamine 2-epimerase [53763] (2 protein domains)
    automatically mapped to Pfam PF02350
  6. 2142097Protein automated matches [197010] (3 species)
    not a true protein
  7. 2142098Species Bacillus subtilis [TaxId:224308] [197011] (1 PDB entry)
  8. 2142100Domain d4fkzb_: 4fkz B: [202044]
    Other proteins in same PDB: d4fkza2
    automated match to d4fkza_
    complexed with ud1, udp

Details for d4fkzb_

PDB Entry: 4fkz (more details), 1.69 Å

PDB Description: Crystal structure of Bacillus subtilis UDP-GlcNAc 2-epimerase in complex with UDP-GlcNAc and UDP
PDB Compounds: (B:) udp-n-acetylglucosamine 2-epimerase

SCOPe Domain Sequences for d4fkzb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fkzb_ c.87.1.3 (B:) automated matches {Bacillus subtilis [TaxId: 224308]}
kklkvmtvfgtrpeaikmaplvlelkkypeidsyvtvtaqhrqmldqvldafhikpdfdl
nimkerqtlaeitsnalvrldelfkdikpdivlvhgdttttfagslaafyhqiavghvea
glrtgnkyspfpeelnrqmtgaiadlhfaptgqakdnllkenkkadsifvtgntaidaln
ttvrdgyshpvldqvgedkmilltahrrenlgepmenmfkairrivgefedvqvvypvhl
npvvreaahkhfgdsdrvhlieplevidfhnfaakshfiltdsggvqeeapslgkpvlvl
rdtterpegveagtlklagtdeeniyqlakqlltdpdeykkmsqasnpygdgeasrrive
ellfhygyrkeqpdsf

SCOPe Domain Coordinates for d4fkzb_:

Click to download the PDB-style file with coordinates for d4fkzb_.
(The format of our PDB-style files is described here.)

Timeline for d4fkzb_: