SCOPe 2.06: Domain d4fkya_: 4fky A:

Lineage for d4fkya_ (4fky A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families)

5. Family d.58.6.0: automated matches [191597] (1 protein)
   not a true family

6. Protein automated matches [191087] (14 species)
   not a true protein

7. Species Trypanosoma brucei [TaxId:999953] [195043] (4 PDB entries)

8. Domain d4fkya_: 4fky A: [202042]
   automated match to d4fkyc_
   complexed with gdp, mg, mpd

Details for d4fkya_

PDB Entry: 4fky, 1.95 Å

PDB Description: Crystal structure of nucleoside diphosphate kinase B from Trypanosoma brucei bound to GTP

PDB Compounds: (A:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d4fkya_:

Sequence; same for both SEQRES and ATOM records:

>d4fkya_ d.58.6.0 (A:) automated matches {Trypanosoma brucei [TaxId: 999953]}
mpsertfiavkpdgvqrnlvgeiikrfenkgyklvglkllqpteeqakqhyidlaskpfy
sglvsyfssgpivgmvweglgvvkggrvllgatnpadslpgtirgdfavdvgrnvchgsd
svesakreiafwfkaeelvswtshsvkqiyer

Timeline for d4fkya_:

• d4fkya_ first appeared in SCOPe 2.03
  
• d4fkya_ appears in SCOPe 2.05
  
• d4fkya_ appears in SCOPe 2.07
  
• d4fkya_ appears in the current release, SCOPe 2.08