| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
| Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
| Protein Dehaloperoxidase [46530] (1 species) |
| Species Amphitrite ornata [TaxId:129555] [46531] (32 PDB entries) |
| Domain d4fh7b_: 4fh7 B: [202035] automated match to d1ew6a_ complexed with hem, moh, oxy, so4, tbp |
PDB Entry: 4fh7 (more details), 1.74 Å
SCOPe Domain Sequences for d4fh7b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4fh7b_ a.1.1.2 (B:) Dehaloperoxidase {Amphitrite ornata [TaxId: 129555]}
gfkqdiatirgdlrtyaqdiflaflnkypderryfknyvgksdqelksmakfgdhtekvf
nlmmevadratdcvplasdantlvqmkqhsslttgnfeklfvalveymrasgqsfdsqsw
drfgknlvsalssagmk
Timeline for d4fh7b_: