Lineage for d1d5bh1 (1d5b H:1-113)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2021376Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2021582Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2022086Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (184 PDB entries)
    Uniprot P01756 1-117 # 78% sequense identity; HV12_MOUSE Ig heavy chain V region MOPC 104E ! SQ NA # humanized antibody ! Uniprot P01750 # HV06_MOUSE Ig heavy chain V region 102 precursor ! Uniprot P01750 20-116 # ! HV06_MOUSE Ig heavy chain V region 102 precursor
  8. 2022276Domain d1d5bh1: 1d5b H:1-113 [20203]
    Other proteins in same PDB: d1d5ba1, d1d5ba2, d1d5bb2, d1d5bh2, d1d5bl1, d1d5bl2
    part of humanized oxy-cope catalytic Fab az-28
    complexed with cd

Details for d1d5bh1

PDB Entry: 1d5b (more details), 2.8 Å

PDB Description: unliganded mature oxy-cope catalytic antibody
PDB Compounds: (H:) chimeric OXY-COPE catalytic ANTIBODY AZ-28 (HEAVY chain)

SCOPe Domain Sequences for d1d5bh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d5bh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]}
qvqlqqsgaelmkpgasvkisckatgytfssfwiewvkqrpghglewigeilpgsggthy
nekfkgkatftadkssntaymqlssltsedsavyycarghsyyfydgdywgqgtsvtvss

SCOPe Domain Coordinates for d1d5bh1:

Click to download the PDB-style file with coordinates for d1d5bh1.
(The format of our PDB-style files is described here.)

Timeline for d1d5bh1: