Lineage for d1d5bh1 (1d5b H:1-113)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 51642Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 51698Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species)
  7. 52717Species Oxy-cope catalytic Fab az-28, chimeric (mouse V domains/human C1 domains) [48839] (4 PDB entries)
  8. 52728Domain d1d5bh1: 1d5b H:1-113 [20203]
    Other proteins in same PDB: d1d5ba2, d1d5bb2, d1d5bh2, d1d5bl2

Details for d1d5bh1

PDB Entry: 1d5b (more details), 2.8 Å

PDB Description: unliganded mature oxy-cope catalytic antibody
PDB Compounds: (H:)

SCOP Domain Sequences for d1d5bh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d5bh1 b.1.1.1 (H:1-113) Immunoglobulin (variable domains of L and H chains) {Oxy-cope catalytic Fab az-28, chimeric (mouse V domains/human C1 domains)}
qvqlqqsgaelmkpgasvkisckatgytfssfwiewvkqrpghglewigeilpgsggthy
nekfkgkatftadkssntaymqlssltsedsavyycarghsyyfydgdywgqgtsvtvss

SCOP Domain Coordinates for d1d5bh1:

Click to download the PDB-style file with coordinates for d1d5bh1.
(The format of our PDB-style files is described here.)

Timeline for d1d5bh1: