SCOPe 2.07: Domain d4f8db_: 4f8d B:

Lineage for d4f8db_ (4f8d B:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
   core: 4 helices; folded leaf, closed

4. Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families)

5. Family a.35.1.0: automated matches [191534] (1 protein)
   not a true family

6. Protein automated matches [190907] (17 species)
   not a true protein

7. Species Enterobacter sp. [TaxId:211595] [189872] (13 PDB entries)

8. Domain d4f8db_: 4f8d B: [202020]
   automated match to d4f8da_
   complexed with na, so4; mutant

Details for d4f8db_

PDB Entry: 4f8d, 1.5 Å

PDB Description: Crystal Structure of an R46A mutant of the Restriction-Modification Controller Protein C.Esp1396I (Monoclinic Form)

PDB Compounds: (B:) Regulatory protein

SCOPe Domain Sequences for d4f8db_:

Sequence; same for both SEQRES and ATOM records:

>d4f8db_ a.35.1.0 (B:) automated matches {Enterobacter sp. [TaxId: 211595]}
esfllskvsfvikkirlekgmtqedlayksnldrtyisgiernsanltikslelimkgle
vsdvvffemlikeilkhd

Timeline for d4f8db_:

• d4f8db_ first appeared in SCOPe 2.03
  
• d4f8db_ appears in SCOPe 2.06
  
• d4f8db_ appears in the current release, SCOPe 2.08