SCOP 1.63: Domain d1d5bl1: 1d5b L:1-107

Lineage for d1d5bl1 (1d5b L:1-107)

Root: SCOP 1.63
Class b: All beta proteins [48724] (119 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (4 families)
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)
Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)
Species Oxy-cope catalytic Fab az-28, chimeric (mouse V domains/human C1 domains) [48839] (4 PDB entries)
Domain d1d5bl1: 1d5b L:1-107 [20202]
Other proteins in same PDB: d1d5ba2, d1d5bb2, d1d5bh2, d1d5bl2

Details for d1d5bl1

PDB Entry: 1d5b (more details), 2.8 Å

PDB Description: unliganded mature oxy-cope catalytic antibody

SCOP Domain Sequences for d1d5bl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d5bl1 b.1.1.1 (L:1-107) Immunoglobulin (variable domains of L and H chains) {Oxy-cope catalytic Fab az-28, chimeric (mouse V domains/human C1 domains)}
dikmtqspssmyaslgervtitckasqdinsylnwfqqkpgkspktliyrtnrlvdgvps
rfsgsgsgqdysltissleyedmgiyyclqydefpytfgsgtkleik

SCOP Domain Coordinates for d1d5bl1:

Click to download the PDB-style file with coordinates for d1d5bl1.
(The format of our PDB-style files is described here.)

Timeline for d1d5bl1: