Lineage for d4f7ea2 (4f7e A:184-278)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1290587Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1291386Protein CD1, alpha-3 domain [88615] (5 species)
  7. 1291387Species Cow (Bos taurus) [TaxId:9913] [226527] (2 PDB entries)
  8. 1291388Domain d4f7ea2: 4f7e A:184-278 [202016]
    Other proteins in same PDB: d4f7ea1, d4f7eb_
    automated match to d1gzqa1
    complexed with 0sh, nag, so4

Details for d4f7ea2

PDB Entry: 4f7e (more details), 2.4 Å

PDB Description: crystal structure of bovine cd1d with bound c16:0-alpha-galactosyl ceramide
PDB Compounds: (A:) CD1D antigen, d polypeptide

SCOPe Domain Sequences for d4f7ea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4f7ea2 b.1.1.2 (A:184-278) CD1, alpha-3 domain {Cow (Bos taurus) [TaxId: 9913]}
qvkpeawlssgpspgpgrlllvchvsgfypkpvrvmwmrgeqeepgtrqgdvmpnadstw
ylrvtldvaagevaglscqvkhsslgdqdiilywh

SCOPe Domain Coordinates for d4f7ea2:

Click to download the PDB-style file with coordinates for d4f7ea2.
(The format of our PDB-style files is described here.)

Timeline for d4f7ea2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4f7ea1
View in 3D
Domains from other chains:
(mouse over for more information)
d4f7eb_