![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein CD1, alpha-3 domain [88615] (5 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [226527] (2 PDB entries) |
![]() | Domain d4f7ea2: 4f7e A:184-277 [202016] Other proteins in same PDB: d4f7ea1, d4f7ea3, d4f7eb_ automated match to d1gzqa1 complexed with 0sh, nag, so4 |
PDB Entry: 4f7e (more details), 2.4 Å
SCOPe Domain Sequences for d4f7ea2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4f7ea2 b.1.1.2 (A:184-277) CD1, alpha-3 domain {Cow (Bos taurus) [TaxId: 9913]} qvkpeawlssgpspgpgrlllvchvsgfypkpvrvmwmrgeqeepgtrqgdvmpnadstw ylrvtldvaagevaglscqvkhsslgdqdiilyw
Timeline for d4f7ea2: