SCOPe 2.08: Domain d4f7ea2: 4f7e A:184-277

Lineage for d4f7ea2 (4f7e A:184-277)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein CD1, alpha-3 domain [88615] (5 species)

7. Species Cow (Bos taurus) [TaxId:9913] [226527] (2 PDB entries)

8. Domain d4f7ea2: 4f7e A:184-277 [202016]
   Other proteins in same PDB: d4f7ea1, d4f7ea3, d4f7eb_
   automated match to d1gzqa1
   complexed with 0sh, nag, so4

Details for d4f7ea2

PDB Entry: 4f7e, 2.4 Å

PDB Description: crystal structure of bovine cd1d with bound c16:0-alpha-galactosyl ceramide

PDB Compounds: (A:) CD1D antigen, d polypeptide

SCOPe Domain Sequences for d4f7ea2:

Sequence; same for both SEQRES and ATOM records:

>d4f7ea2 b.1.1.2 (A:184-277) CD1, alpha-3 domain {Cow (Bos taurus) [TaxId: 9913]}
qvkpeawlssgpspgpgrlllvchvsgfypkpvrvmwmrgeqeepgtrqgdvmpnadstw
ylrvtldvaagevaglscqvkhsslgdqdiilyw

Timeline for d4f7ea2:

• d4f7ea2 first appeared in SCOPe 2.03
  
• d4f7ea2 appears in SCOPe 2.07