Lineage for d4f7ea1 (4f7e A:8-183)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1405985Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1405986Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 1405987Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1405988Protein CD1, alpha-1 and alpha-2 domains [54456] (5 species)
    Class I MHC-related
  7. 1405989Species Cow (Bos taurus) [TaxId:9913] [226526] (2 PDB entries)
  8. 1405990Domain d4f7ea1: 4f7e A:8-183 [202015]
    Other proteins in same PDB: d4f7ea2, d4f7eb_
    automated match to d1gzpa2
    complexed with 0sh, nag, so4

Details for d4f7ea1

PDB Entry: 4f7e (more details), 2.4 Å

PDB Description: crystal structure of bovine cd1d with bound c16:0-alpha-galactosyl ceramide
PDB Compounds: (A:) CD1D antigen, d polypeptide

SCOPe Domain Sequences for d4f7ea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4f7ea1 d.19.1.1 (A:8-183) CD1, alpha-1 and alpha-2 domains {Cow (Bos taurus) [TaxId: 9913]}
fsfqglqissfanrswtrtdglawlgelqpytwrnesdtirflkpwsrgtfsdqqweqlq
htllvyrssftrdiwefveklhveypleiqiatgcellprnisesflraafqgrdvlsfq
gmswvsapdappfiqevikvlnqnqgtketvhwllhdiwpelvrgvlqtgkselek

SCOPe Domain Coordinates for d4f7ea1:

Click to download the PDB-style file with coordinates for d4f7ea1.
(The format of our PDB-style files is described here.)

Timeline for d4f7ea1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4f7ea2
View in 3D
Domains from other chains:
(mouse over for more information)
d4f7eb_