![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
![]() | Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) ![]() |
![]() | Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
![]() | Protein CD1, alpha-1 and alpha-2 domains [54456] (5 species) Class I MHC-related |
![]() | Species Cow (Bos taurus) [TaxId:9913] [226526] (2 PDB entries) |
![]() | Domain d4f7ea1: 4f7e A:8-183 [202015] Other proteins in same PDB: d4f7ea2, d4f7ea3, d4f7eb_ automated match to d1gzpa2 complexed with 0sh, nag, so4 |
PDB Entry: 4f7e (more details), 2.4 Å
SCOPe Domain Sequences for d4f7ea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4f7ea1 d.19.1.1 (A:8-183) CD1, alpha-1 and alpha-2 domains {Cow (Bos taurus) [TaxId: 9913]} fsfqglqissfanrswtrtdglawlgelqpytwrnesdtirflkpwsrgtfsdqqweqlq htllvyrssftrdiwefveklhveypleiqiatgcellprnisesflraafqgrdvlsfq gmswvsapdappfiqevikvlnqnqgtketvhwllhdiwpelvrgvlqtgkselek
Timeline for d4f7ea1: