SCOPe 2.08: Domain d4f7ea1: 4f7e A:8-183

Lineage for d4f7ea1 (4f7e A:8-183)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein CD1, alpha-1 and alpha-2 domains [54456] (5 species)
   Class I MHC-related

7. Species Cow (Bos taurus) [TaxId:9913] [226526] (2 PDB entries)

8. Domain d4f7ea1: 4f7e A:8-183 [202015]
   Other proteins in same PDB: d4f7ea2, d4f7ea3, d4f7eb_
   automated match to d1gzpa2
   complexed with 0sh, nag, so4

Details for d4f7ea1

PDB Entry: 4f7e, 2.4 Å

PDB Description: crystal structure of bovine cd1d with bound c16:0-alpha-galactosyl ceramide

PDB Compounds: (A:) CD1D antigen, d polypeptide

SCOPe Domain Sequences for d4f7ea1:

Sequence; same for both SEQRES and ATOM records:

>d4f7ea1 d.19.1.1 (A:8-183) CD1, alpha-1 and alpha-2 domains {Cow (Bos taurus) [TaxId: 9913]}
fsfqglqissfanrswtrtdglawlgelqpytwrnesdtirflkpwsrgtfsdqqweqlq
htllvyrssftrdiwefveklhveypleiqiatgcellprnisesflraafqgrdvlsfq
gmswvsapdappfiqevikvlnqnqgtketvhwllhdiwpelvrgvlqtgkselek

Timeline for d4f7ea1:

• d4f7ea1 first appeared in SCOPe 2.03
  
• d4f7ea1 appears in SCOPe 2.07