SCOPe 2.03: Domain d4f7cc2: 4f7c C:184-279

Lineage for d4f7cc2 (4f7c C:184-279)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein CD1, alpha-3 domain [88615] (5 species)

7. Species Cow (Bos taurus) [TaxId:9913] [226527] (2 PDB entries)

8. Domain d4f7cc2: 4f7c C:184-279 [202014]
   Other proteins in same PDB: d4f7ca1, d4f7cb_, d4f7cc1, d4f7cd_
   automated match to d1gzqa1
   complexed with 0sg

Details for d4f7cc2

PDB Entry: 4f7c, 2.86 Å

PDB Description: crystal structure of bovine cd1d with bound c12-di-sulfatide

PDB Compounds: (C:) CD1D antigen, d polypeptide

SCOPe Domain Sequences for d4f7cc2:

Sequence, based on SEQRES records:

>d4f7cc2 b.1.1.2 (C:184-279) CD1, alpha-3 domain {Cow (Bos taurus) [TaxId: 9913]}
qvkpeawlssgpspgpgrlllvchvsgfypkpvrvmwmrgeqeepgtrqgdvmpnadstw
ylrvtldvaagevaglscqvkhsslgdqdiilywhh

Sequence, based on observed residues (ATOM records):

>d4f7cc2 b.1.1.2 (C:184-279) CD1, alpha-3 domain {Cow (Bos taurus) [TaxId: 9913]}
qvkpeawlssgpspgpgrlllvchvsgfypkpvrvmwmrgeqeepgtrqgdvmpnadstw
ylrvtldvaglscqvkhsslgdqdiilywhh

Timeline for d4f7cc2:

• d4f7cc2 is new in SCOPe 2.03-stable
  
• d4f7cc2 appears in SCOPe 2.04
  
• d4f7cc2 appears in the current release, SCOPe 2.08