Lineage for d4f7ca1 (4f7c A:7-183)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937550Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2937551Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2937552Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2937553Protein CD1, alpha-1 and alpha-2 domains [54456] (5 species)
    Class I MHC-related
  7. 2937554Species Cow (Bos taurus) [TaxId:9913] [226526] (2 PDB entries)
  8. 2937556Domain d4f7ca1: 4f7c A:7-183 [202011]
    Other proteins in same PDB: d4f7ca2, d4f7ca3, d4f7cb_, d4f7cc2, d4f7cc3, d4f7cd_
    automated match to d1gzpa2
    complexed with 0sg

Details for d4f7ca1

PDB Entry: 4f7c (more details), 2.86 Å

PDB Description: crystal structure of bovine cd1d with bound c12-di-sulfatide
PDB Compounds: (A:) CD1D antigen, d polypeptide

SCOPe Domain Sequences for d4f7ca1:

Sequence, based on SEQRES records: (download)

>d4f7ca1 d.19.1.1 (A:7-183) CD1, alpha-1 and alpha-2 domains {Cow (Bos taurus) [TaxId: 9913]}
pfsfqglqissfanrswtrtdglawlgelqpytwrnesdtirflkpwsrgtfsdqqweql
qhtllvyrssftrdiwefveklhveypleiqiatgcellprnisesflraafqgrdvlsf
qgmswvsapdappfiqevikvlnqnqgtketvhwllhdiwpelvrgvlqtgkselek

Sequence, based on observed residues (ATOM records): (download)

>d4f7ca1 d.19.1.1 (A:7-183) CD1, alpha-1 and alpha-2 domains {Cow (Bos taurus) [TaxId: 9913]}
pfsfqglqissfanrswtrtdglawlgelqpytwrnesdtirflkpwsrgtfsdqqweql
qhtllvyrssftrdiwefveklhveypleiqiatgcellsesflraafqgrdvlsfqgms
wvsapdappfiqevikvlnqnqgtketvhwllhdiwpelvrgvlqtgkselek

SCOPe Domain Coordinates for d4f7ca1:

Click to download the PDB-style file with coordinates for d4f7ca1.
(The format of our PDB-style files is described here.)

Timeline for d4f7ca1: