Lineage for d4f6rb2 (4f6r B:246-441)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1914038Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 1914315Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 1914316Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)
  6. 1914423Protein automated matches [227071] (5 species)
    not a true protein
  7. 1914492Species Sheep (Ovis aries) [TaxId:9940] [226224] (11 PDB entries)
  8. 1914512Domain d4f6rb2: 4f6r B:246-441 [202010]
    Other proteins in same PDB: d4f6ra1, d4f6rb1, d4f6rd_
    automated match to d1z2bb2
    complexed with gdp, gtp, mes, mg, so4

Details for d4f6rb2

PDB Entry: 4f6r (more details), 2.64 Å

PDB Description: Tubulin:Stathmin-like domain complex
PDB Compounds: (B:) Tubulin beta chain

SCOPe Domain Sequences for d4f6rb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4f6rb2 d.79.2.1 (B:246-441) automated matches {Sheep (Ovis aries) [TaxId: 9940]}
gqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdsknmmaac
dprhgryltvatifrgrmsmkevdeqmlniqnknssyfvewipnnvktavcdipprglkm
sstfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyq
qyqdatad

SCOPe Domain Coordinates for d4f6rb2:

Click to download the PDB-style file with coordinates for d4f6rb2.
(The format of our PDB-style files is described here.)

Timeline for d4f6rb2: