Lineage for d1axsb1 (1axs B:1-113)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 287097Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (21 proteins)
  6. 287195Protein Immunoglobulin heavy chain variable domain, VH [88543] (19 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogeneous CDRs are listed as engineered species
  7. 287419Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (118 PDB entries)
  8. 287517Domain d1axsb1: 1axs B:1-113 [20201]
    Other proteins in same PDB: d1axsa1, d1axsa2, d1axsb2, d1axsh2, d1axsl1, d1axsl2
    part of humanized oxy-cope catalytic Fab az-28
    complexed with cd, hop

Details for d1axsb1

PDB Entry: 1axs (more details), 2.6 Å

PDB Description: mature oxy-cope catalytic antibody with hapten

SCOP Domain Sequences for d1axsb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1axsb1 b.1.1.1 (B:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2}
qvqllesgaelmkpgasvkisckatgytfssfwiewvkqrpghglewigeilpgsggthy
nekfkgkatftadkssntaymqlssltsedsavyycarghsyyfydgdywgqgtsvtvss

SCOP Domain Coordinates for d1axsb1:

Click to download the PDB-style file with coordinates for d1axsb1.
(The format of our PDB-style files is described here.)

Timeline for d1axsb1: