Lineage for d1axsb1 (1axs B:1-113)
- Root: SCOP 1.57
Class b: All beta proteins [48724] (104 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins) 
Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species) 
Species Oxy-cope catalytic Fab az-28, chimeric (mouse V domains/human C1 domains) [48839] (4 PDB entries) 
Domain d1axsb1: 1axs B:1-113 [20201]
Other proteins in same PDB: d1axsa2, d1axsb2, d1axsh2, d1axsl2
Details for d1axsb1
PDB Entry: 1axs (more details), 2.6 Å
PDB Description: mature oxy-cope catalytic antibody with hapten
SCOP Domain Sequences for d1axsb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1axsb1 b.1.1.1 (B:1-113) Immunoglobulin (variable domains of L and H chains) {Oxy-cope catalytic Fab az-28, chimeric (mouse V domains/human C1 domains)}
qvqllesgaelmkpgasvkisckatgytfssfwiewvkqrpghglewigeilpgsggthy
nekfkgkatftadkssntaymqlssltsedsavyycarghsyyfydgdywgqgtsvtvss
SCOP Domain Coordinates for d1axsb1:
Click to download the PDB-style file with coordinates for d1axsb1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1axsb1:
View in 3D
