SCOPe 2.08: Domain d4f5ma1: 4f5m A:12-406

Lineage for d4f5ma1 (4f5m A:12-406)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.1: PLP-dependent transferases [53383] (10 families)

5. Family c.67.1.1: AAT-like [53384] (17 proteins)

6. Protein automated matches [190317] (4 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [196886] (8 PDB entries)

8. Domain d4f5ma1: 4f5m A:12-406 [202005]
   Other proteins in same PDB: d4f5ma2, d4f5mb2
   automated match to d4f5mb_
   complexed with edo

Details for d4f5ma1

PDB Entry: 4f5m, 1.65 Å

PDB Description: Wild-Type E. coli Aspartate Aminotransferase: A Template For The Interconversion of Substrate Specificity and Activity To Tyrosine Aminotransferase By The JANUS Algorithm.

PDB Compounds: (A:) aspartate aminotransferase

SCOPe Domain Sequences for d4f5ma1:

Sequence; same for both SEQRES and ATOM records:

>d4f5ma1 c.67.1.1 (A:12-406) automated matches {Escherichia coli K-12 [TaxId: 83333]}
fenitaapadpilgladlfraderpgkinlgigvykdetgktpvltsvkkaeqyllenet
tknylgidgipefgrctqellfgkgsalindkrartaqtpggtgalrvaadflakntsvk
rvwvsnpswpnhksvfnsaglevreyayydaenhtldfdalinslneaqagdvvlfhgcc
hnptgidptleqwqtlaqlsvekgwlplfdfayqgfargleedaeglrafaamhkeliva
ssysknfglynervgactlvaadsetvdrafsqmkaairanysnppahgasvvatilsnd
alraiweqeltdmrqriqrmrqlfvntlqekganrdfsfiikqngmfsfsgltkeqvlrl
reefgvyavasgrvnvagmtpdnmaplceaivavl

Timeline for d4f5ma1:

• d4f5ma1 first appeared in SCOPe 2.03, called d4f5ma_
  
• d4f5ma1 appears in SCOPe 2.07