Lineage for d4f5lb1 (4f5l B:12-406)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2130992Family c.67.1.1: AAT-like [53384] (17 protein domains)
  6. 2131336Protein automated matches [190317] (5 species)
    not a true protein
  7. 2131337Species Escherichia coli K-12 [TaxId:83333] [196886] (8 PDB entries)
  8. 2131339Domain d4f5lb1: 4f5l B:12-406 [202004]
    Other proteins in same PDB: d4f5la2, d4f5lb2
    automated match to d4f5la_
    complexed with edo; mutant

Details for d4f5lb1

PDB Entry: 4f5l (more details), 1.4 Å

PDB Description: A Theoretical Optimized Mutant for the Conversion of Substrate Specificity and Activity of Aspartate Aminotransferase to Tyrosine Aminotransferase: Chimera P7.
PDB Compounds: (B:) aspartate aminotransferase

SCOPe Domain Sequences for d4f5lb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4f5lb1 c.67.1.1 (B:12-406) automated matches {Escherichia coli K-12 [TaxId: 83333]}
fenitaapadpilgladlfraderpgkvdlgvgvykdetgktpvmtsvkkaeqyllenet
tktylgldglpefgrctqellfgkgsalindkrartaqtpggsgalrvaadflakntsvk
rvwvsnptwpnhkaifnsaglevreyayydaenhtldfdalinslneaqagdvvlfhgcc
hnptgadptleqwqtlaqlsvekgwlplidiayqgfgrgleedaeglrafaamhkeliva
sscsknfglynervgactlvaadsetvdrafsqmkaairanyssppahgasvvatilsnd
alraiweqeltdmrqriqrmrqlfvntlqekganrdfsfiikqngmfsfsgltkeqvlrl
reefgvyavasgrinvagmtpdnmaplceaivavl

SCOPe Domain Coordinates for d4f5lb1:

Click to download the PDB-style file with coordinates for d4f5lb1.
(The format of our PDB-style files is described here.)

Timeline for d4f5lb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4f5lb2