Lineage for d4f5ka1 (4f5k A:12-406)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2895166Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2895167Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2895168Family c.67.1.1: AAT-like [53384] (17 proteins)
  6. 2895545Protein automated matches [190317] (4 species)
    not a true protein
  7. 2895546Species Escherichia coli K-12 [TaxId:83333] [196886] (8 PDB entries)
  8. 2895559Domain d4f5ka1: 4f5k A:12-406 [202003]
    Other proteins in same PDB: d4f5ka2, d4f5kb2
    automated match to d4f5kb_

Details for d4f5ka1

PDB Entry: 4f5k (more details), 2.2 Å

PDB Description: Substrate Specificity Conversion of Aspartate Aminotransferase to Tyrosine Aminotransferase By The JANUS Algorithm: Chimera P6.
PDB Compounds: (A:) aspartate aminotransferase

SCOPe Domain Sequences for d4f5ka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4f5ka1 c.67.1.1 (A:12-406) automated matches {Escherichia coli K-12 [TaxId: 83333]}
fenitaapadpilgladlfraderpgkvdlgvgvykdetgktpvmtsvkkaeqyllenet
tktylgldglpefgrctqellfgkgsalindkrartaqtpggsgalrvaadflakntsvk
rvwvsnptwpnhkaifnsaglevreyayydaenhtldfdalinslneaqagdvvlfhgcc
hnptgadptleqwqtlaqlsvekgwlplidiayqgfgrgleedaeglrafaamhkeliva
sscsknfslynervgactlvaadsetvdrafgqmkaairanysnppahgasvvatilsnd
alraiweqeltdmrqriqrmrqlfvntlqekganrdfsfiikqngmfsfsgltkeqvlrl
reefgvyavasgrinvagmtpdnmaplceaivavl

SCOPe Domain Coordinates for d4f5ka1:

Click to download the PDB-style file with coordinates for d4f5ka1.
(The format of our PDB-style files is described here.)

Timeline for d4f5ka1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4f5ka2