Lineage for d4f5ib_ (4f5i B:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1613158Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 1613159Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 1613160Family c.67.1.1: AAT-like [53384] (17 proteins)
  6. 1613503Protein automated matches [190317] (4 species)
    not a true protein
  7. 1613504Species Escherichia coli K-12 [TaxId:83333] [196886] (8 PDB entries)
  8. 1613516Domain d4f5ib_: 4f5i B: [202001]
    automated match to d4f5ia_
    complexed with mpd

Details for d4f5ib_

PDB Entry: 4f5i (more details), 2.2 Å

PDB Description: Substrate Specificity Conversion of E. coli Pyridoxal-5'-Phosphate Dependent Aspartate Aminotransferase to Tyrosine Aminotransferase: Chimera P4.
PDB Compounds: (B:) aspartate aminotransferase

SCOPe Domain Sequences for d4f5ib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4f5ib_ c.67.1.1 (B:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
hhvgtfenitaapadpilgladlfraderpgkvdlgvgvykdetgktpvmtsvkkaeqyl
lenettktylgidgipefgrctqellfgkgsalindkrartaqtpggsgalrvaadflak
ntsvkrvwvsnptwpnhkaifnsaglevreyayydaenhtldfdalinslneaqagdvvl
fhgcchnptgidptleqwqtlaqlsvekgwlplidiayqgfgrgleedaeglrafaamhk
elivasscsknfslynervgactlvaadsetvdrafsqmkaairanyssppahgasvvat
ilsndalraiweqeltdmrqriqrmrqlfvntlqekganrdfsfiikqngmfsfsgltke
qvlrlreefgvyavasgrinvagmtpdnmaplceaivavl

SCOPe Domain Coordinates for d4f5ib_:

Click to download the PDB-style file with coordinates for d4f5ib_.
(The format of our PDB-style files is described here.)

Timeline for d4f5ib_: