Lineage for d4f53a_ (4f53 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2007336Superfamily a.118.8: TPR-like [48452] (9 families) (S)
  5. 2007586Family a.118.8.0: automated matches [191581] (1 protein)
    not a true family
  6. 2007587Protein automated matches [191037] (12 species)
    not a true protein
  7. 2007593Species Bacteroides ovatus [TaxId:411476] [194986] (1 PDB entry)
  8. 2007594Domain d4f53a_: 4f53 A: [201997]
    automated match to d4f53b_
    complexed with act, ca, cl, gol

Details for d4f53a_

PDB Entry: 4f53 (more details), 2.25 Å

PDB Description: crystal structure of a susd homolog (bacova_04803) from bacteroides ovatus atcc 8483 at 2.25 a resolution
PDB Compounds: (A:) SusD homolog

SCOPe Domain Sequences for d4f53a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4f53a_ a.118.8.0 (A:) automated matches {Bacteroides ovatus [TaxId: 411476]}
vdwylvrslalnlqdlmmpeqenfsqyvdclmagafsgyvadsnlgtgwsgryatynpsd
dwkkipfndfyskfypdyfnlknqsddelflslaelyrivvmlrvtdtygpipyskvgaa
naikspydsqqavyakmledldniitvlgkfgnqsfsssadriyngntsawykfanslkl
rmamrtcyvagfnvngktsqqlaeeavaagvmtaatdgayrkvadhnpwqrfmvlwsdar
isadltcymnayndprreayydkstfgtvsgnaytgeesyvglrrgilqgqynswsqgss
cmkvttsdnivvfrasevaflraegalrnwnmggtakdfyeegirlsfeengitsgveny
lastgkveaykdplkgqsaqtydysgaintnvtvawsggdfeksleqiitqkwianfpng
meswteyrrtgypklmpmaanasggivndaegarrmpyptdeyrenresveaavatltqe
sktkrgdtmathvwwdck

SCOPe Domain Coordinates for d4f53a_:

Click to download the PDB-style file with coordinates for d4f53a_.
(The format of our PDB-style files is described here.)

Timeline for d4f53a_: