SCOPe 2.08: Domain d4f49a1: 4f49 A:1-299

Lineage for d4f49a1 (4f49 A:1-299)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (5 proteins)

6. Protein Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) [74979] (8 species)
   contains an extra alpha-helical domain

7. Species Porcine transmissible gastroenteritis coronavirus [TaxId:11151] [193539] (1 PDB entry)

8. Domain d4f49a1: 4f49 A:1-299 [201993]
   Other proteins in same PDB: d4f49a2, d4f49c2, d4f49d2
   automated match to d4f49b_
   complexed with k36, pg4
   has additional subdomain(s) that are not in the common domain

Details for d4f49a1

PDB Entry: 4f49, 2.25 Å

PDB Description: 2.25a resolution structure of transmissible gastroenteritis virus protease containing a covalently bound dipeptidyl inhibitor

PDB Compounds: (A:) 3C-like proteinase

SCOPe Domain Sequences for d4f49a1:

Sequence; same for both SEQRES and ATOM records:

>d4f49a1 b.47.1.4 (A:1-299) Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) {Porcine transmissible gastroenteritis coronavirus [TaxId: 11151]}
sglrkmaqpsglvepcivrvsygnnvlnglwlgdevicprhviasdttrvinyenemssv
rlhnfsvsknnvflgvvsarykgvnlvlkvnqvnpntpehkfksikagesfnilacyegc
pgsvygvnmrsqgtikgsfiagtcgsvgyvlengilyfvymhhlelgngshvgsnfegem
yggyedqpsmqlegtnvmssdnvvaflyaalingerwfvtntsmslesyntwaktnsfte
lsstdafsmlaaktgqsveklldsivrlnkgfggrtilsygslcdeftptevirqmygv

Timeline for d4f49a1:

• d4f49a1 first appeared in SCOPe 2.03, called d4f49a_
  
• d4f49a1 appears in SCOPe 2.07