| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies) core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest |
Superfamily c.97.1: Cytidine deaminase-like [53927] (7 families) ![]() contains extra C-terminal strand 5, order 21345 |
| Family c.97.1.0: automated matches [191471] (1 protein) not a true family |
| Protein automated matches [190746] (16 species) not a true protein |
| Species Mycobacterium marinum [TaxId:216594] [195312] (1 PDB entry) |
| Domain d4f3wd_: 4f3w D: [201990] automated match to d4f3wb_ complexed with zn |
PDB Entry: 4f3w (more details), 1.8 Å
SCOPe Domain Sequences for d4f3wd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4f3wd_ c.97.1.0 (D:) automated matches {Mycobacterium marinum [TaxId: 216594]}
didwkqlrdkatqvaagayapysrfpvgaaalvddgrvvtgcnvenvsyglalcaecgvv
calhatgggrlvalacvdgrgaplmpcgrcrqllfehggpellvdhlagprrlgdllpep
Timeline for d4f3wd_: