Lineage for d1axsh1 (1axs H:1-113)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 651989Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)
  6. 652160Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 652563Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (148 PDB entries)
  8. 652695Domain d1axsh1: 1axs H:1-113 [20199]
    Other proteins in same PDB: d1axsa1, d1axsa2, d1axsb2, d1axsh2, d1axsl1, d1axsl2

Details for d1axsh1

PDB Entry: 1axs (more details), 2.6 Å

PDB Description: mature oxy-cope catalytic antibody with hapten
PDB Compounds: (H:) oxy-cope catalytic antibody

SCOP Domain Sequences for d1axsh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1axsh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]}
qvqllesgaelmkpgasvkisckatgytfssfwiewvkqrpghglewigeilpgsggthy
nekfkgkatftadkssntaymqlssltsedsavyycarghsyyfydgdywgqgtsvtvss

SCOP Domain Coordinates for d1axsh1:

Click to download the PDB-style file with coordinates for d1axsh1.
(The format of our PDB-style files is described here.)

Timeline for d1axsh1: