SCOP 1.55: Domain d1axsh1: 1axs H:1-113

Lineage for d1axsh1 (1axs H:1-113)

Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)
Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)
Species Oxy-cope catalytic Fab az-28, chimeric (mouse V domains/human C1 domains) [48839] (4 PDB entries)
Domain d1axsh1: 1axs H:1-113 [20199]
Other proteins in same PDB: d1axsa2, d1axsb2, d1axsh2, d1axsl2

Details for d1axsh1

PDB Entry: 1axs (more details), 2.6 Å

PDB Description: mature oxy-cope catalytic antibody with hapten

SCOP Domain Sequences for d1axsh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1axsh1 b.1.1.1 (H:1-113) Immunoglobulin (variable domains of L and H chains) {Oxy-cope catalytic Fab az-28, chimeric (mouse V domains/human C1 domains)}
qvqllesgaelmkpgasvkisckatgytfssfwiewvkqrpghglewigeilpgsggthy
nekfkgkatftadkssntaymqlssltsedsavyycarghsyyfydgdywgqgtsvtvss

SCOP Domain Coordinates for d1axsh1:

Click to download the PDB-style file with coordinates for d1axsh1.
(The format of our PDB-style files is described here.)

Timeline for d1axsh1: