Lineage for d4f3rb_ (4f3r B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2860044Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2860045Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2860806Family c.26.1.0: automated matches [191377] (1 protein)
    not a true family
  6. 2860807Protein automated matches [190459] (61 species)
    not a true protein
  7. 2860893Species Coxiella burnetii [TaxId:227377] [195012] (1 PDB entry)
  8. 2860895Domain d4f3rb_: 4f3r B: [201989]
    automated match to d4f3rc_
    complexed with ca

Details for d4f3rb_

PDB Entry: 4f3r (more details), 2.25 Å

PDB Description: structure of phosphopantetheine adenylyltransferase (cbu_0288) from coxiella burnetii
PDB Compounds: (B:) phosphopantetheine adenylyltransferase

SCOPe Domain Sequences for d4f3rb_:

Sequence, based on SEQRES records: (download)

>d4f3rb_ c.26.1.0 (B:) automated matches {Coxiella burnetii [TaxId: 227377]}
mkpiaiypgtfdpltnghvdiieralplfnkiivacaptsrkdphlkleervnliadvlt
dervevlpltgllvdfakthqanfilrglravsdfdyefqlahmnyqlspeietiflpar
egysyvsgtmvreivtlggdvspfvpplvarhlqk

Sequence, based on observed residues (ATOM records): (download)

>d4f3rb_ c.26.1.0 (B:) automated matches {Coxiella burnetii [TaxId: 227377]}
mkpiaiypgtfdpltnghvdiieralplfnkiivacaptlkleervnliadvltdervev
lpltgllvdfakthqanfilrglravsdfdyefqlahmnyqlspeietiflparegysyv
sgtmvreivtlggdvspfvpplvarhlqk

SCOPe Domain Coordinates for d4f3rb_:

Click to download the PDB-style file with coordinates for d4f3rb_.
(The format of our PDB-style files is described here.)

Timeline for d4f3rb_: