Lineage for d4f36f_ (4f36 F:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2951070Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) (S)
  5. 2951611Family d.58.6.0: automated matches [191597] (1 protein)
    not a true family
  6. 2951612Protein automated matches [191087] (19 species)
    not a true protein
  7. 2951834Species Trypanosoma brucei [TaxId:999953] [195043] (4 PDB entries)
  8. 2951849Domain d4f36f_: 4f36 F: [201987]
    Other proteins in same PDB: d4f36e2
    automated match to d4f4aa_
    complexed with scn

Details for d4f36f_

PDB Entry: 4f36 (more details), 2.3 Å

PDB Description: Crystal structure of Nucleoside diphosphate kinase B from Trypanosoma brucei, apo form
PDB Compounds: (F:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d4f36f_:

Sequence, based on SEQRES records: (download)

>d4f36f_ d.58.6.0 (F:) automated matches {Trypanosoma brucei [TaxId: 999953]}
sertfiavkpdgvqrnlvgeiikrfenkgyklvglkllqpteeqakqhyidlaskpfysg
lvsyfssgpivgmvweglgvvkggrvllgatnpadslpgtirgdfavdvgrnvchgsdsv
esakreiafwfkaeelvswtshsvkqiye

Sequence, based on observed residues (ATOM records): (download)

>d4f36f_ d.58.6.0 (F:) automated matches {Trypanosoma brucei [TaxId: 999953]}
sertfiavkpdgvqrnlvgeiikrfenkgyklvglkllqpteeqakqhyidlasgpivgm
vweglgvvkggrvllgatnpadslpgtirgdfavdvgrnvchgsdsvesakreiafwfka
eelvswtshsvkqiye

SCOPe Domain Coordinates for d4f36f_:

Click to download the PDB-style file with coordinates for d4f36f_.
(The format of our PDB-style files is described here.)

Timeline for d4f36f_: