Lineage for d4f36c_ (4f36 C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2951070Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) (S)
  5. 2951611Family d.58.6.0: automated matches [191597] (1 protein)
    not a true family
  6. 2951612Protein automated matches [191087] (19 species)
    not a true protein
  7. 2951834Species Trypanosoma brucei [TaxId:999953] [195043] (4 PDB entries)
  8. 2951846Domain d4f36c_: 4f36 C: [201985]
    Other proteins in same PDB: d4f36e2
    automated match to d4f36e_
    complexed with scn

Details for d4f36c_

PDB Entry: 4f36 (more details), 2.3 Å

PDB Description: Crystal structure of Nucleoside diphosphate kinase B from Trypanosoma brucei, apo form
PDB Compounds: (C:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d4f36c_:

Sequence, based on SEQRES records: (download)

>d4f36c_ d.58.6.0 (C:) automated matches {Trypanosoma brucei [TaxId: 999953]}
sertfiavkpdgvqrnlvgeiikrfenkgyklvglkllqpteeqakqhyidlaskpfysg
lvsyfssgpivgmvweglgvvkggrvllgatnpadslpgtirgdfavdvgrnvchgsdsv
esakreiafwfkaeelvswtshsvkqiyera

Sequence, based on observed residues (ATOM records): (download)

>d4f36c_ d.58.6.0 (C:) automated matches {Trypanosoma brucei [TaxId: 999953]}
sertfiavkpdgvqrnlvgeiikrfenkgyklvglkllqpteeqakqhglvsyfssgpiv
gmvweglgvvkggrvllgatnpadslpgtirgdfavdvgrnvchgsdsvesakreiafwf
kaeelvswtshsvkqiyera

SCOPe Domain Coordinates for d4f36c_:

Click to download the PDB-style file with coordinates for d4f36c_.
(The format of our PDB-style files is described here.)

Timeline for d4f36c_: