SCOPe 2.05: Domain d4f36b_: 4f36 B:

Lineage for d4f36b_ (4f36 B:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families)

5. Family d.58.6.0: automated matches [191597] (1 protein)
   not a true family

6. Protein automated matches [191087] (10 species)
   not a true protein

7. Species Trypanosoma brucei [TaxId:999953] [195043] (4 PDB entries)

8. Domain d4f36b_: 4f36 B: [201984]
   automated match to d4f4ac_
   complexed with scn

Details for d4f36b_

PDB Entry: 4f36, 2.3 Å

PDB Description: Crystal structure of Nucleoside diphosphate kinase B from Trypanosoma brucei, apo form

PDB Compounds: (B:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d4f36b_:

Sequence, based on SEQRES records:

>d4f36b_ d.58.6.0 (B:) automated matches {Trypanosoma brucei [TaxId: 999953]}
psertfiavkpdgvqrnlvgeiikrfenkgyklvglkllqpteeqakqhyidlaskpfys
glvsyfssgpivgmvweglgvvkggrvllgatnpadslpgtirgdfavdvgrnvchgsds
vesakreiafwfkaeelvswtshsvkqiyer

Sequence, based on observed residues (ATOM records):

>d4f36b_ d.58.6.0 (B:) automated matches {Trypanosoma brucei [TaxId: 999953]}
psertfiavkpdgvqrnlvgeiikrfenkgyklvglkllqpteeqakqhglvsyfssgpi
vgmvweglgvvkggrvllgatnpadslpgtirgdfavdvgrnvchgsdsvesakreiafw
fkaeelvswtshsvkqiyer

Timeline for d4f36b_:

• d4f36b_ first appeared in SCOPe 2.03
  
• d4f36b_ appears in SCOPe 2.04
  
• d4f36b_ appears in SCOPe 2.06
  
• d4f36b_ appears in the current release, SCOPe 2.08