SCOPe 2.04: Domain d4f0ud_: 4f0u D:

Lineage for d4f0ud_ (4f0u D:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins)
   oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
   binds a bilin chromophore
   automatically mapped to Pfam PF00502

6. Protein automated matches [190531] (15 species)
   not a true protein

7. Species Synechococcus elongatus [TaxId:1140] [193231] (2 PDB entries)

8. Domain d4f0ud_: 4f0u D: [201982]
   automated match to d4f0uf_
   complexed with cyc

Details for d4f0ud_

PDB Entry: 4f0u, 2.5 Å

PDB Description: X-Ray Crystal Structure of Allophycocyanin from Synechococcus elongatus PCC 7942

PDB Compounds: (D:) Allophycocyanin, beta subunit

SCOPe Domain Sequences for d4f0ud_:

Sequence; same for both SEQRES and ATOM records:

>d4f0ud_ a.1.1.3 (D:) automated matches {Synechococcus elongatus [TaxId: 1140]}
mqdaitavinasdvqgkyldssaldrlksyfqsgelrvraaatisansalivkeavaksl
lysditrpggnmyttrryaacirdleyylryatyamlagdtsildervlnglketynslg
vpigatvqaiqaikevtaslvgpdagremgvyldyissgls

Timeline for d4f0ud_:

• d4f0ud_ first appeared in SCOPe 2.03
  
• d4f0ud_ appears in SCOPe 2.05
  
• d4f0ud_ appears in the current release, SCOPe 2.08