| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
| Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins) oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus binds a bilin chromophore automatically mapped to Pfam PF00502 |
| Protein automated matches [190531] (23 species) not a true protein |
| Species Synechococcus elongatus [TaxId:1140] [193231] (2 PDB entries) |
| Domain d4f0ud_: 4f0u D: [201982] automated match to d4f0uf_ complexed with cyc |
PDB Entry: 4f0u (more details), 2.5 Å
SCOPe Domain Sequences for d4f0ud_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4f0ud_ a.1.1.3 (D:) automated matches {Synechococcus elongatus [TaxId: 1140]}
mqdaitavinasdvqgkyldssaldrlksyfqsgelrvraaatisansalivkeavaksl
lysditrpggnmyttrryaacirdleyylryatyamlagdtsildervlnglketynslg
vpigatvqaiqaikevtaslvgpdagremgvyldyissgls
Timeline for d4f0ud_: