Lineage for d4f0ua_ (4f0u A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1715732Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1715733Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1718119Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins)
    oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
    binds a bilin chromophore
    automatically mapped to Pfam PF00502
  6. 1718294Protein automated matches [190531] (16 species)
    not a true protein
  7. 1718436Species Synechococcus elongatus [TaxId:1140] [193231] (2 PDB entries)
  8. 1718461Domain d4f0ua_: 4f0u A: [201981]
    automated match to d4f0uc_
    complexed with cyc

Details for d4f0ua_

PDB Entry: 4f0u (more details), 2.5 Å

PDB Description: X-Ray Crystal Structure of Allophycocyanin from Synechococcus elongatus PCC 7942
PDB Compounds: (A:) allophycocyanin alpha chain

SCOPe Domain Sequences for d4f0ua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4f0ua_ a.1.1.3 (A:) automated matches {Synechococcus elongatus [TaxId: 1140]}
sivsksivnadaearylspgeleriktfvvggdrrlriaqtiaesrerivkqagnqlfqk
rpdvvspggnaygedmtatclrdldyylrlvtygvvsgditpieeigivgvremykslgt
pieavaegvrelksaatalltgedadeagayfdyvigals

SCOPe Domain Coordinates for d4f0ua_:

Click to download the PDB-style file with coordinates for d4f0ua_.
(The format of our PDB-style files is described here.)

Timeline for d4f0ua_: