Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) C-terminal domain is beta/alpha barrel |
Family d.58.9.0: automated matches [227234] (1 protein) not a true family |
Protein automated matches [226983] (27 species) not a true protein |
Species Red algae (Galdieria sulphuraria) [TaxId:130081] [226524] (3 PDB entries) |
Domain d4f0ka1: 4f0k A:27-158 [201979] Other proteins in same PDB: d4f0ka2, d4f0kb_ automated match to d1bwva2 complexed with cl, co2, gol, mg |
PDB Entry: 4f0k (more details), 2.05 Å
SCOPe Domain Sequences for d4f0ka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4f0ka1 d.58.9.0 (A:27-158) automated matches {Red algae (Galdieria sulphuraria) [TaxId: 130081]} pyakmgywnpdyqvkdtdvlalfrvtpqpgvdpieaaaavagesstatwtvvwtdlltaa dlyrakaykvdqvpnnpeqyfayiayeldlfeegsianltasiignvfgfkavkalrled mrlpfayiktfq
Timeline for d4f0ka1: