Class b: All beta proteins [48724] (180 folds) |
Fold b.62: Cyclophilin-like [50890] (1 superfamily) barrel, closed; n=8, S=10; complex topology |
Superfamily b.62.1: Cyclophilin-like [50891] (5 families) |
Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins) automatically mapped to Pfam PF00160 |
Protein automated matches [190077] (22 species) not a true protein |
Species Piriformospora indica [TaxId:65672] [197083] (1 PDB entry) |
Domain d4eyvc_: 4eyv C: [201978] automated match to d4eyva_ complexed with k, na, po4 |
PDB Entry: 4eyv (more details), 1.97 Å
SCOPe Domain Sequences for d4eyvc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4eyvc_ b.62.1.1 (C:) automated matches {Piriformospora indica [TaxId: 65672]} qpnvyfdisidnqnagrivfklyddvvpltaknfrelaknpagqgytgstfhriipqfml qggdftnhngtggrsiygnkfkdenfqlkhtkpgllsmanagphtngsqffittvvtswl dgkhvvfgevvegmdvvkkveavgtqsgkpskvvkitasgtv
Timeline for d4eyvc_: