Lineage for d4eyvb_ (4eyv B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2806645Fold b.62: Cyclophilin-like [50890] (1 superfamily)
    barrel, closed; n=8, S=10; complex topology
  4. 2806646Superfamily b.62.1: Cyclophilin-like [50891] (5 families) (S)
  5. 2806647Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins)
    automatically mapped to Pfam PF00160
  6. 2806997Protein automated matches [190077] (22 species)
    not a true protein
  7. 2807065Species Piriformospora indica [TaxId:65672] [197083] (1 PDB entry)
  8. 2807067Domain d4eyvb_: 4eyv B: [201977]
    automated match to d4eyva_
    complexed with k, na, po4

Details for d4eyvb_

PDB Entry: 4eyv (more details), 1.97 Å

PDB Description: Crystal structure of Cyclophilin A like protein from Piriformospora indica
PDB Compounds: (B:) peptidyl-prolyl cis-trans isomerase

SCOPe Domain Sequences for d4eyvb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4eyvb_ b.62.1.1 (B:) automated matches {Piriformospora indica [TaxId: 65672]}
qpnvyfdisidnqnagrivfklyddvvpltaknfrelaknpagqgytgstfhriipqfml
qggdftnhngtggrsiygnkfkdenfqlkhtkpgllsmanagphtngsqffittvvtswl
dgkhvvfgevvegmdvvkkveavgtqsgkpskvvkitasgtv

SCOPe Domain Coordinates for d4eyvb_:

Click to download the PDB-style file with coordinates for d4eyvb_.
(The format of our PDB-style files is described here.)

Timeline for d4eyvb_: