Lineage for d1d6vh1 (1d6v H:1-113)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 362616Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 362617Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (24 proteins)
  6. 362751Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 363037Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (141 PDB entries)
  8. 363087Domain d1d6vh1: 1d6v H:1-113 [20197]
    Other proteins in same PDB: d1d6vh2, d1d6vl1, d1d6vl2
    part of humanized oxy-cope catalytic Fab az-28

Details for d1d6vh1

PDB Entry: 1d6v (more details), 2 Å

PDB Description: conformation effects in biological catalysis introduced by oxy-cope antibody maturation

SCOP Domain Sequences for d1d6vh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d6vh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2}
qvqlqqsgaelmkpgasvkisckatgytfssywiewvkqrpghglewigeilpgsgstny
nekfkgkatftadtssntaymqlssltsedsavyycarghsyyfydgdywgqgtsvtvss

SCOP Domain Coordinates for d1d6vh1:

Click to download the PDB-style file with coordinates for d1d6vh1.
(The format of our PDB-style files is described here.)

Timeline for d1d6vh1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1d6vh2