SCOPe 2.08: Domain d4eu2n_: 4eu2 N:

Lineage for d4eu2n_ (4eu2 N:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein Proteasome beta subunit (catalytic) [56252] (7 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56254] (202 PDB entries)
   The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)

8. Domain d4eu2n_: 4eu2 N: [201964]
   Other proteins in same PDB: d4eu2a_, d4eu2c_, d4eu2d_, d4eu2e_, d4eu2f_, d4eu2g_, d4eu2i_, d4eu2j_, d4eu2o_, d4eu2s_
   automated match to d1rypn_
   complexed with wpi

Details for d4eu2n_

PDB Entry: 4eu2, 2.51 Å

PDB Description: Crystal structure of 20s proteasome with novel inhibitor K-7174

PDB Compounds: (N:) Proteasome component PRE4

SCOPe Domain Sequences for d4eu2n_:

Sequence; same for both SEQRES and ATOM records:

>d4eu2n_ d.153.1.4 (N:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tqqpivtgtsvismkydngviiaadnlgsygsllrfngverlipvgdntvvgisgdisdm
qhierllkdlvtenaydnpladaeealepsyifeylatvmyqrrskmnplwnaiivagvq
sngdqflryvnllgvtyssptlatgfgahmanpllrkvvdresdipkttvqvaeeaivna
mrvlyyrdarssrnfslaiidkntgltfkknlqvenmkwdfakdikgygtqki

Timeline for d4eu2n_:

• d4eu2n_ first appeared in SCOPe 2.03
  
• d4eu2n_ appears in SCOPe 2.07