![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
![]() | Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
![]() | Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
![]() | Protein automated matches [190359] (43 species) not a true protein |
![]() | Species Eleginops maclovinus [TaxId:56733] [193401] (2 PDB entries) |
![]() | Domain d4esab_: 4esa B: [201953] automated match to d4esad_ complexed with cmo, gol, hem |
PDB Entry: 4esa (more details), 1.45 Å
SCOPe Domain Sequences for d4esab_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4esab_ a.1.1.2 (B:) automated matches {Eleginops maclovinus [TaxId: 56733]} vewtdqeratissifgsldyddigpkalsrclivypwtqrhfgsfgnlynaeaiignqkv aahgikvlhgldravknmdnikeiyaelsilhseklhvdpdnfklladcltivvaakmgs gfnpgtqatfqkflavvvsalgkq
Timeline for d4esab_: