Lineage for d4es4f_ (4es4 F:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2347984Fold a.145: Flagellar transcriptional activator FlhD [63591] (1 superfamily)
    multihelical; forms intertwined dimer of identical 5-helical subunits
  4. 2347985Superfamily a.145.1: Flagellar transcriptional activator FlhD [63592] (1 family) (S)
  5. 2347986Family a.145.1.1: Flagellar transcriptional activator FlhD [63593] (1 protein)
    contains an HTH motif
  6. 2347987Protein Flagellar transcriptional activator FlhD [63594] (1 species)
  7. 2347988Species Escherichia coli [TaxId:562] [63595] (3 PDB entries)
  8. 2347997Domain d4es4f_: 4es4 F: [201951]
    automated match to d1g8ea_

Details for d4es4f_

PDB Entry: 4es4 (more details), 2.9 Å

PDB Description: Crystal structure of YdiV and FlhD complex
PDB Compounds: (F:) Flagellar transcriptional regulator FlhD

SCOPe Domain Sequences for d4es4f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4es4f_ a.145.1.1 (F:) Flagellar transcriptional activator FlhD {Escherichia coli [TaxId: 562]}
htsellkhiydinlsylllaqrlivqdkasamfrlgineemattlaaltlpqmvklaetn
qlvchfrfdshqtitqltqd

SCOPe Domain Coordinates for d4es4f_:

Click to download the PDB-style file with coordinates for d4es4f_.
(The format of our PDB-style files is described here.)

Timeline for d4es4f_: