Class a: All alpha proteins [46456] (289 folds) |
Fold a.145: Flagellar transcriptional activator FlhD [63591] (1 superfamily) multihelical; forms intertwined dimer of identical 5-helical subunits |
Superfamily a.145.1: Flagellar transcriptional activator FlhD [63592] (1 family) |
Family a.145.1.1: Flagellar transcriptional activator FlhD [63593] (1 protein) contains an HTH motif |
Protein Flagellar transcriptional activator FlhD [63594] (1 species) |
Species Escherichia coli [TaxId:562] [63595] (3 PDB entries) |
Domain d4es4f_: 4es4 F: [201951] automated match to d1g8ea_ |
PDB Entry: 4es4 (more details), 2.9 Å
SCOPe Domain Sequences for d4es4f_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4es4f_ a.145.1.1 (F:) Flagellar transcriptional activator FlhD {Escherichia coli [TaxId: 562]} htsellkhiydinlsylllaqrlivqdkasamfrlgineemattlaaltlpqmvklaetn qlvchfrfdshqtitqltqd
Timeline for d4es4f_: