| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
| Family a.25.1.4: YciF-like [140445] (3 proteins) Pfam PF05974; DUF892 |
| Protein automated matches [195225] (1 species) not a true protein |
| Species Salmonella enterica [TaxId:588858] [195226] (1 PDB entry) |
| Domain d4erua1: 4eru A:1-158 [201949] Other proteins in same PDB: d4erua2 automated match to d4erub_ complexed with mg, mlt |
PDB Entry: 4eru (more details), 2.1 Å
SCOPe Domain Sequences for d4erua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4erua1 a.25.1.4 (A:1-158) automated matches {Salmonella enterica [TaxId: 588858]}
mniktvedlfihllsdtysaekqltkalpklaratsneklsqafqshleetqgqieridq
ivesesgiklkrmkcvameglieeaneviesteknevrdaaliaaaqkvehyeiasygtl
atlaeqlgyskalkllketldeekqtdlkltdlavsnv
Timeline for d4erua1: