SCOPe 2.08: Domain d4erua1: 4eru A:1-158

Lineage for d4erua1 (4eru A:1-158)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.4: YciF-like [140445] (3 proteins)
   Pfam PF05974; DUF892

6. Protein automated matches [195225] (1 species)
   not a true protein

7. Species Salmonella enterica [TaxId:588858] [195226] (1 PDB entry)

8. Domain d4erua1: 4eru A:1-158 [201949]
   Other proteins in same PDB: d4erua2
   automated match to d4erub_
   complexed with mg, mlt

Details for d4erua1

PDB Entry: 4eru, 2.1 Å

PDB Description: Crystal Structure of Putative Cytoplasmic Protein, YciF Bacterial Stress Response Protein from Salmonella enterica

PDB Compounds: (A:) YciF Bacterial Stress Response Protein

SCOPe Domain Sequences for d4erua1:

Sequence; same for both SEQRES and ATOM records:

>d4erua1 a.25.1.4 (A:1-158) automated matches {Salmonella enterica [TaxId: 588858]}
mniktvedlfihllsdtysaekqltkalpklaratsneklsqafqshleetqgqieridq
ivesesgiklkrmkcvameglieeaneviesteknevrdaaliaaaqkvehyeiasygtl
atlaeqlgyskalkllketldeekqtdlkltdlavsnv

Timeline for d4erua1:

• d4erua1 first appeared in SCOPe 2.03, called d4erua_
  
• d4erua1 appears in SCOPe 2.07