SCOPe 2.08: Domain d4eq1b1: 4eq1 B:357-464

Lineage for d4eq1b1 (4eq1 B:357-464)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.110: Profilin-like [55769] (10 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families)
   alpha-beta(2)-alpha(2)-beta(3)

5. Family d.110.3.0: automated matches [191387] (1 protein)
   not a true family

6. Protein automated matches [190492] (24 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187434] (30 PDB entries)

8. Domain d4eq1b1: 4eq1 B:357-464 [201946]
   Other proteins in same PDB: d4eq1a2, d4eq1b2
   automated match to d4eq1a_
   complexed with pe5

Details for d4eq1b1

PDB Entry: 4eq1, 1.6 Å

PDB Description: crystal structure of the arnt pas-b homodimer

PDB Compounds: (B:) Aryl hydrocarbon receptor nuclear translocator

SCOPe Domain Sequences for d4eq1b1:

Sequence; same for both SEQRES and ATOM records:

>d4eq1b1 d.110.3.0 (B:357-464) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vcqptefisrhniegiftfvdhrcvatvgyqpqellgknivefchpedqqllrdsfqqvv
klkgqvlsvmfrfrsknqewlwmrtssftfqnpysdeieyiictntnv

Timeline for d4eq1b1:

• d4eq1b1 first appeared in SCOPe 2.03, called d4eq1b_
  
• d4eq1b1 appears in SCOPe 2.07