SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d4ep8c1 (4ep8 C:1002-1129,C:1423-1475)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2073462Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily)
    pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns
  4. 2073463Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (12 families) (S)
    this domain is interrupted by the catalytic beta/alpha barrel domain
  5. 2073464Family b.92.1.1: alpha-Subunit of urease [51339] (1 protein)
  6. 2073465Protein alpha-Subunit of urease [51340] (4 species)
  7. 2073476Species Enterobacter aerogenes [TaxId:548] [224871] (4 PDB entries)
  8. 2073477Domain d4ep8c1: 4ep8 C:1002-1129,C:1423-1475 [201934]
    Other proteins in same PDB: d4ep8a_, d4ep8b_, d4ep8c2
    automated match to d1ef2a1
    complexed with ni

Details for d4ep8c1

PDB Entry: 4ep8 (more details), 1.55 Å

PDB Description: Initial Urease Structure for Radiation Damage Experiment at 100 K
PDB Compounds: (C:) urease subunit alpha

SCOPe Domain Sequences for d4ep8c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ep8c1 b.92.1.1 (C:1002-1129,C:1423-1475) alpha-Subunit of urease {Enterobacter aerogenes [TaxId: 548]}
snisrqayadmfgptvgdkvrladtelwieveddlttygeevkfgggkvirdgmgqgqml
aadcvdlvltnalivdhwgivkadigvkdgrifaigkagnpdiqpnvtipigaateviaa
egkivtagXsievgkladlvvwspaffgvkpatvikggmiaiapmgdinasiptpqpvhy
rp

SCOPe Domain Coordinates for d4ep8c1:

Click to download the PDB-style file with coordinates for d4ep8c1.
(The format of our PDB-style files is described here.)

Timeline for d4ep8c1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4ep8c2