Lineage for d4eosd1 (4eos D:175-309)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2718075Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 2718076Superfamily a.74.1: Cyclin-like [47954] (4 families) (S)
    duplication: consists of two domains of this fold
  5. 2718077Family a.74.1.1: Cyclin [47955] (9 proteins)
  6. 2718090Protein Cyclin A [47956] (2 species)
  7. 2718126Species Human (Homo sapiens) [TaxId:9606] [47957] (89 PDB entries)
    Uniprot P20248 175-432
  8. 2718285Domain d4eosd1: 4eos D:175-309 [201931]
    Other proteins in same PDB: d4eosa1, d4eosa2, d4eosc1, d4eosc2
    automated match to d1h1pb1
    complexed with 1ro

Details for d4eosd1

PDB Entry: 4eos (more details), 2.57 Å

PDB Description: Thr 160 phosphorylated CDK2 WT - human cyclin A3 complex with the inhibitor RO3306
PDB Compounds: (D:) Cyclin-A2

SCOPe Domain Sequences for d4eosd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4eosd1 a.74.1.1 (D:175-309) Cyclin A {Human (Homo sapiens) [TaxId: 9606]}
vpdyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhl
avnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrm
ehlvlkvltfdlaap

SCOPe Domain Coordinates for d4eosd1:

Click to download the PDB-style file with coordinates for d4eosd1.
(The format of our PDB-style files is described here.)

Timeline for d4eosd1: