SCOP 1.73: Domain d1aqkh1: 1aqk H:1-123

Lineage for d1aqkh1 (1aqk H:1-123)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Human (Homo sapiens), cluster 3 [TaxId:9606] [88547] (19 PDB entries)

8. Domain d1aqkh1: 1aqk H:1-123 [20193]
   Other proteins in same PDB: d1aqkh2, d1aqkl1, d1aqkl2
   part of Fab B7-15A2

Details for d1aqkh1

PDB Entry: 1aqk, 1.84 Å

PDB Description: three-dimensional structure of a human fab with high affinity for tetanus toxoid

PDB Compounds: (H:) fab b7-15a2

SCOP Domain Sequences for d1aqkh1:

Sequence; same for both SEQRES and ATOM records:

>d1aqkh1 b.1.1.1 (H:1-123) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 3 [TaxId: 9606]}
evqlvesgggvvqpgrslrlscaasgftfnnyaihwvrqapgkglewvafisydgsknyy
adsvkgrftisrdnskntlflqmnslrpedtaiyycarvlfqqlvlyapfdiwgqgtmvt
vss

Timeline for d1aqkh1:

• d1aqkh1 first appeared (with stable ids) in SCOP 1.55
  
• d1aqkh1 appears in SCOP 1.71
  
• d1aqkh1 appears in SCOP 1.75
  
• d1aqkh1 appears in the current release, SCOPe 2.08