SCOPe 2.03: Domain d4eorc_: 4eor C:

Lineage for d4eorc_ (4eor C:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein Cyclin-dependent PK, CDK2 [88855] (2 species)
   CMGC group; CDKs subfamily; serine/threonine kinase

7. Species Human (Homo sapiens) [TaxId:9606] [88856] (335 PDB entries)
   Uniprot P24941

8. Domain d4eorc_: 4eor C: [201926]
   Other proteins in same PDB: d4eorb1, d4eorb2, d4eord1, d4eord2
   automated match to d1w98a_
   complexed with 4sp

Details for d4eorc_

PDB Entry: 4eor, 2.2 Å

PDB Description: Thr 160 phosphorylated CDK2 WT - human cyclin A3 complex with the inhibitor NU6102

PDB Compounds: (C:) cyclin-dependent kinase 2

SCOPe Domain Sequences for d4eorc_:

Sequence, based on SEQRES records:

>d4eorc_ d.144.1.7 (C:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]}
smenfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstaireisllkeln
hpnivklldvihtenklylvfeflhqdlkkfmdasaltgiplpliksylfqllqglafch
shrvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillgcky
ystavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdykps
fpkwarqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvp

Sequence, based on observed residues (ATOM records):

>d4eorc_ d.144.1.7 (C:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]}
smenfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstaireisllkeln
hpnivklldvihtenklylvfeflhqdlkkfmdasaltgiplpliksylfqllqglafch
shrvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillgcky
ystavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdfskvvppldedgrsll
sqmlhydpnkrisakaalahpffqdvtkpvp

Timeline for d4eorc_:

• d4eorc_ is new in SCOPe 2.03-stable
  
• d4eorc_ appears in SCOPe 2.04
  
• d4eorc_ appears in the current release, SCOPe 2.08, called d4eorc1