| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.74: Cyclin-like [47953] (1 superfamily) core: 5 helices; one helix is surrounded by the others |
Superfamily a.74.1: Cyclin-like [47954] (4 families) ![]() duplication: consists of two domains of this fold |
| Family a.74.1.1: Cyclin [47955] (9 proteins) |
| Protein Cyclin A [47956] (2 species) |
| Species Human (Homo sapiens) [TaxId:9606] [47957] (89 PDB entries) Uniprot P20248 175-432 |
| Domain d4eoqd2: 4eoq D:310-429 [201923] Other proteins in same PDB: d4eoqa1, d4eoqa2, d4eoqc1, d4eoqc2 automated match to d1h1pb2 complexed with atp, mg, sgm |
PDB Entry: 4eoq (more details), 2.15 Å
SCOPe Domain Sequences for d4eoqd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4eoqd2 a.74.1.1 (D:310-429) Cyclin A {Human (Homo sapiens) [TaxId: 9606]}
tvnqfltqyflhqqpanckveslamflgelslidadpylkylpsviagaafhlalytvtg
qswpeslirktgytleslkpclmdlhqtylkapqhaqqsirekyknskyhgvsllnppet
Timeline for d4eoqd2: